PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0045s0123.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 261aa    MW: 28294.8 Da    PI: 8.633
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0045s0123.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.51.9e-18187220134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +Cg+ kTp+WR gpdg+ktLCnaCG++y++ +
  Kaladp0045s0123.1.p 187 CKHCGSEKTPQWRAGPDGPKTLCNACGVRYKSGR 220
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-15181231IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.374181217IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.38E-14184244No hitNo description
Gene3DG3DSA:3.30.50.104.1E-14185218IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.10E-13186234No hitNo description
PfamPF003203.1E-16187221IPR000679Zinc finger, GATA-type
PROSITE patternPS003440187212IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGFFDTAPSA CFIDDLLNFN IDDNDRDKAN GSKNPKSLSP PNTFFPLPES EEEEELEWLS  60
NKDVFPSVDT FVPSVETFVD VIPVEPSTGV LKHVSPVSVL ENSISSFGSN NSNDSNAVIT  120
TCCIGRGLAP PIRRPRSRGS QKRRRGGFVD ISSQQWFICC SSIHTNKTGN NAAKASGIAS  180
GITGRKCKHC GSEKTPQWRA GPDGPKTLCN ACGVRYKSGR LCPEYRPASS PTFSSAVHSN  240
SHRKILEMKK MKQHNGKPCG *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285624.12e-60PREDICTED: GATA transcription factor 1 isoform X2
TrEMBLF6HS482e-60F6HS48_VITVI; Putative uncharacterized protein
STRINGVIT_05s0051g00450.t016e-60(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-42GATA transcription factor 1